DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ACA4

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_193831.1 Gene:ACA4 / 827846 AraportID:AT4G20990 Length:267 Species:Arabidopsis thaliana


Alignment Length:303 Identity:69/303 - (22%)
Similarity:113/303 - (37%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVARSFAPINSGTRSH--------FGFNYDKQ--------GR---DWNV-KCGERQSPIALWS 45
            :|.:|..|..::....||        ..|.|:::        |:   .|.| ..|..||||.|  
plant     8 IFFMAMCFIYLSFPNISHAHSEVDDETPFTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDL-- 70

  Fly    46 CNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVL---------MRIPKTVDGSRPSLCISTEGQQ 101
            .|.....:....:...:|..  |..:.|.|..::         |.|.||                
plant    71 TNERVSLIHDQAWTRQYKPA--PAVITNRGHDIMVSWKGDAGKMTIRKT---------------- 117

  Fly   102 VFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLE 166
            .|...|.|:|      ..|||.::|..||.|:|:||.:|..::           ||:.:..: |.
plant   118 DFNLVQCHWH------SPSEHTVNGTRYDLELHMVHTSARGRT-----------AVIGVLYK-LG 164

  Fly   167 DPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWF 231
            :||   ..:..:...:.::...:.:..:.|...::     ..::|::.|.||||.|||.|.|||.
plant   165 EPN---EFLTKLLNGIKAVGNKEINLGMIDPREIR-----FQTRKFYRYIGSLTVPPCTEGVIWT 221

  Fly   232 VFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDRPVY 274
            |......:..|   ....||.:.|.......|.:||...|.|:
plant   222 VVKRVNTISME---QITALRQAVDDGFETNSRPVQDSKGRSVW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 58/247 (23%)
ACA4NP_193831.1 PLN02179 1..226 CDD:177835 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.