DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ACA1

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001319732.1 Gene:ACA1 / 824438 AraportID:AT3G52720 Length:284 Species:Arabidopsis thaliana


Alignment Length:174 Identity:51/174 - (29%)
Similarity:71/174 - (40%) Gaps:35/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLA-LFIRNLEDPNIE 171
            |..||.:.    |||.|.|..|..|:|:||:           .:...|||:| ||....|:|   
plant   116 LQMHWHTP----SEHHLHGVQYAAELHMVHQ-----------AKDGSFAVVASLFKIGTEEP--- 162

  Fly   172 TPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASID-------SQKYFTYQGSLTTPPCAEAVI 229
                 .:.:....:.||.:. .|:.:...|.....||       ::||:.|.||||||||:|.|.
plant   163 -----FLSQMKEKLVKLKEE-RLKGNHTAQVEVGRIDTRHIERKTRKYYRYIGSLTTPPCSENVS 221

  Fly   230 WFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
            |.:......:.||   ....||...|....|..|..|..:.|.|
plant   222 WTILGKVRSMSKE---QVELLRSPLDTSFKNNSRPCQPLNGRRV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 51/174 (29%)
ACA1NP_001319732.1 alpha_CA 1..284 CDD:381753 51/174 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.