DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca15b

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_005169499.1 Gene:ca15b / 791844 ZFINID:ZDB-GENE-040426-2222 Length:320 Species:Danio rerio


Alignment Length:250 Identity:75/250 - (30%)
Similarity:117/250 - (46%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GERQSPIALWSCNA-ITCNVPKLKFLNYHKSLCDPLSVI-NNGLTVLMRI-PK---TVDGSRPSL 93
            |.:||||.:.:.|. ...|:....::.|:.|..  |:|| |.|.::.:.: ||   ...|:.|..
Zfish    48 GTQQSPINIVTANVKANANLTSFTYVGYNDSTA--LTVIKNTGTSIQVTLDPKKMRVAGGNLPGR 110

  Fly    94 CISTEGQQVFEADQLHFHWGS-ALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAV 157
            ..|||         .|.|||: :...||||.::|..:..|:|||:|..|..|        :..||
Zfish   111 FASTE---------FHLHWGNGSAMPGSEHTVNGKRFPMELHIVNKPVSNTS--------DSLAV 158

  Fly   158 LALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTP 222
            |.:||....:.. :..:...:...::.|.|..|...|..:.::.||.:.:|..||:.|.||||||
Zfish   159 LGVFIEASNETG-KPESWKTLTSYLTRIVKAGDKASLFRNFSMDDLLSGVDRTKYYRYLGSLTTP 222

  Fly   223 PCAEAVIWFVFPTPLDVPKELWKHF----WQLRDSRDQRVLNTYRELQDGHDRPV 273
            .|.|.|||.||..|:.|.::|...|    :....|....:.|.:|.:|..:.|.|
Zfish   223 NCNEGVIWTVFKDPIRVSRDLIDLFSTTVYINNSSNSPLMTNIFRSVQPVNGRIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 74/249 (30%)
ca15bXP_005169499.1 alpha_CA_IV_XV_like 48..279 CDD:239391 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579168
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_129602
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.