DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and car1_predicted

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001072785.1 Gene:car1_predicted / 780246 -ID:- Length:258 Species:Xenopus tropicalis


Alignment Length:293 Identity:80/293 - (27%)
Similarity:122/293 - (41%) Gaps:87/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APINSGTRS--------HFGFNYDKQ--------GRDWNVKCGERQSPIALWSCNAITCNVPKLK 57
            :|||..||:        ...|:||.:        |..:||:                        
 Frog    17 SPININTRTAKYNPSLKPLKFSYDPKTAKRIVNVGHCFNVE------------------------ 57

  Fly    58 FLNYHKSLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEH 122
                .:.:||. ||::.|         .:|| ...||            |.||||||:...||||
 Frog    58 ----FEDICDK-SVLSEG---------PLDG-HYRLC------------QFHFHWGSSDRDGSEH 95

  Fly   123 CLDGNYYDGEVHIVHKNA-SYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSIT 186
            .:||:.|..|:||||.|: .|.|..||...|:|.||:.:|:: |.:.|   ||:..|.:.:..:.
 Frog    96 NIDGHLYPAELHIVHWNSKKYTSFAEAAKHPDGVAVVGVFLK-LGNTN---PALQSIIENLDKVK 156

  Fly   187 KLDDSCPLED----SMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHF 247
            ....:||..:    .:..:||       .|:||.|||||.|..|.|.|.:....:.|..:..:.|
 Frog   157 TKGKACPFTEFHLNGLLPEDL-------NYWTYMGSLTTKPYFECVTWIILQEAITVSSQQLEQF 214

  Fly   248 WQLRDSRDQR----VLNTYRELQDGHDRPVYRS 276
            .:|:.:.:..    :|..:|.:|....|.||.|
 Frog   215 RRLQCTSENENPSFILENHRPVQPLDHRVVYSS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 66/247 (27%)
car1_predictedNP_001072785.1 alpha_CA 16..247 CDD:381753 79/291 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.