DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and XB5797209

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_002931952.3 Gene:XB5797209 / 779564 XenbaseID:XB-GENE-5797210 Length:323 Species:Xenopus tropicalis


Alignment Length:274 Identity:92/274 - (33%)
Similarity:131/274 - (47%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RDWNVKC-GERQSPIALWSCNAITCNVPKLK-----------FLNYHKSLCDPLSVINNGLTVLM 80
            :|.:..| ||.||||          |:.:.|           |..|..:......:||:|.:||:
 Frog    40 KDISHNCGGESQSPI----------NIERSKVKRDSHLGGISFQGYDHATPGRWKLINDGHSVLL 94

  Fly    81 RIPKTVDGSRPSLCISTEG-QQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKS 144
            .:...|..|..:  ||..| ...:.|.|.||||||:...||||.:||..|..|:||||.||.|:|
 Frog    95 SLSGEVIQSHVN--ISGAGLPNTYRALQFHFHWGSSTRDGSEHLMDGKQYPMELHIVHMNAKYQS 157

  Fly   145 NKEAGLQPNGFAVLALF--IRNLEDPNIETPAMNMICKQVS---SITKLDDSCPLEDSMALQDLF 204
            ..||...|.|.|||..|  :..:::|:..|....|  |.||   ...:||.:.|||..:...|..
 Frog   158 ITEAKKDPQGLAVLGFFFTVSEIDNPSYNTLEAGM--KNVSLKGEFIELDSTFPLEMLLPPHDKL 220

  Fly   205 ASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWK------HFWQLRDSRDQRVLNTYR 263
            :     :|:.||||||||.|:|.|||.||..|:.:.::..|      ||....::. .::.:.:|
 Frog   221 S-----RYYRYQGSLTTPDCSEVVIWTVFEDPISISQKQLKIMTETAHFTANGETL-VKMSDNFR 279

  Fly   264 ELQDGHDRPVYRSK 277
            ..|....|.|:.||
 Frog   280 TPQPLKGRKVWASK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 87/261 (33%)
XB5797209XP_002931952.3 Carb_anhydrase 46..287 CDD:395141 87/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.