DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CA11

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001208.2 Gene:CA11 / 770 HGNCID:1370 Length:328 Species:Homo sapiens


Alignment Length:257 Identity:69/257 - (26%)
Similarity:122/257 - (47%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WNVKC--GERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMRIPKT------V 86
            |:: |  |:||||:.:           :||.:.|...| .||.:...|..:...:..|      :
Human    59 WSL-CAVGKRQSPVDV-----------ELKRVLYDPFL-PPLRLSTGGEKLRGTLYNTGRHVSFL 110

  Fly    87 DGSRPSLCISTEGQQVF--EADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAG 149
            ...||.:.:| .|..::  ...:|...:|:....||||.::...:..||.::|.|.....|..|.
Human   111 PAPRPVVNVS-GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAA 174

  Fly   150 LQ-PNGFAVLALFIRNLEDPNIETPAMNMICKQ--VSSITKLDDSCPLEDSMALQDLFASIDSQK 211
            .: |||.|:|:||:......|   |.::.:..:  ::.|:..:|:..|:| ::|:.||.  :|..
Human   175 SRGPNGLAILSLFVNVASTSN---PFLSRLLNRDTITRISYKNDAYFLQD-LSLELLFP--ESFG 233

  Fly   212 YFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
            :.||||||:||||:|.|.|.:....|:: ..|..|..:|........:  ::.| .|:.||:
Human   234 FITYQGSLSTPPCSETVTWILIDRALNI-TSLQMHSLRLLSQNPPSQI--FQSL-SGNSRPL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 67/250 (27%)
CA11NP_001208.2 alpha_CARP_X_XI_like 48..304 CDD:239395 69/257 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.