DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca15c

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001070801.1 Gene:ca15c / 768190 ZFINID:ZDB-GENE-061013-737 Length:324 Species:Danio rerio


Alignment Length:257 Identity:78/257 - (30%)
Similarity:116/257 - (45%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GERQSPIALWSCNAITCNV---PKLKFLNY--HKSLCDPLSVINNGLTVLM----RIPKTVDGSR 90
            |..||||     |.:|..|   |.|...|.  ..:.....|:.|.|::|::    :|.....|..
Zfish    48 GSSQSPI-----NIVTAQVQENPNLTQFNLTGFDANTTFTSITNAGVSVVVNLDDKIMSVQGGDL 107

  Fly    91 PSLCISTEGQQVFEADQLHFHWGSALS-KGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGL---Q 151
            |.|.:|         ...|.||||..| .||||.::|..|..|:|||:.::.|..:....|   .
Zfish   108 PGLYVS---------KNFHLHWGSGSSLPGSEHTVNGKQYAMELHIVNVHSKYNGSVSVALAAHD 163

  Fly   152 PNGFAVLALFIRNLEDPNIETPAMNMICKQVSSI-TKLDDSCPLEDSMALQDLFASIDSQKYFTY 215
            .:..|||..||...::.| :|...:::...::.| .|.|.:..:.:.:.:..|...:|..||:.|
Zfish   164 SSALAVLGFFIEGTDEAN-KTKGWDVLTSFLTKIPNKNDTTVDIMNQITMNSLLEGVDKTKYYRY 227

  Fly   216 QGSLTTPPCAEAVIWFVFPTPLDVPKELWKHF----WQLRDSRDQRVLNTYRELQDGHDRPV 273
            |||||||.|.|||||.||..|:.|...|...|    :....|....:.|.:|.:|..:.|.|
Zfish   228 QGSLTTPDCNEAVIWTVFKEPIKVSNNLINRFSTTVFTKTTSAPVLIFNNFRGVQPLNGRVV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 78/257 (30%)
ca15cNP_001070801.1 alpha_CA_IV_XV_like 48..291 CDD:239391 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579166
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.