DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CA6

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_011540386.1 Gene:CA6 / 765 HGNCID:1380 Length:324 Species:Homo sapiens


Alignment Length:303 Identity:100/303 - (33%)
Similarity:143/303 - (47%) Gaps:68/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVARSFAPINSGTRS-------HFGFNYDKQGRDWNVKCGERQSPIALWSCNAITCNVPKLKF 58
            :||:......::..|.|       |:..:|...|       |:|||||.| ....:..| |.||.
Human    14 LFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACG-------GQRQSPINL-QRTKVRYN-PSLKG 69

  Fly    59 LNY--HKSLCDPLSVINNGLTVLMRIPKTV-----DGSRPSLCISTEGQQVFEADQLHFHWGSAL 116
            ||.  :::......::|||.||.:.:|.|:     ||:            |:.|.|:|||||.|.
Human    70 LNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGT------------VYIAQQMHFHWGGAS 122

  Fly   117 SK--GSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDP----------- 168
            |:  ||||.:||..:..|:||||.|:.|||...|...|:|.||||.|:.....|           
Human   123 SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISH 187

  Fly   169 --NIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWF 231
              ||:.|.      |.:::|.||          :||:... :.|.|:||.||||||||.|.|.||
Human   188 LANIKYPG------QRTTLTGLD----------VQDMLPR-NLQHYYTYHGSLTTPPCTENVHWF 235

  Fly   232 VFPTPLDVPK-ELWKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
            |....:.:.: ::||....|.|.|::.:.|.||..|..:.|.|
Human   236 VLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 93/262 (35%)
CA6XP_011540386.1 alpha_CA_VI 35..283 CDD:239399 96/282 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm41271
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.