DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Car12

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_006511611.1 Gene:Car12 / 76459 MGIID:1923709 Length:355 Species:Mus musculus


Alignment Length:285 Identity:82/285 - (28%)
Similarity:135/285 - (47%) Gaps:33/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFAPINSGTRSHFGFNYDKQGRDWNVK---CGE-RQSPIALWS-CNAITCNVPKLKFLNYHKSLC 66
            |.||:|....::.|...:|   :|:.|   ||. .||||.|.| ......::..|:|..|:.|:.
Mouse    23 SSAPLNGSKWTYVGPAGEK---NWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVE 84

  Fly    67 DPLSVINNGLTVLMRIPKT--VDGSRPSLCISTEGQQVFEADQLHFHWGSALS-KGSEHCLDGNY 128
            ..|::.|:|.:|.:.:...  :.|.:|         ..:.|:|||.|||:... .||||.:.|.:
Mouse    85 KLLNLTNDGHSVRLNLNSDMYIQGLQP---------HHYRAEQLHLHWGNRNDPHGSEHTVSGKH 140

  Fly   129 YDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSC 192
            :..|:||||.|:. |.....|..:..|.||||:.|    :.....|:.:.|...:..: |.....
Mouse   141 FAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLI----EIGSANPSYDKIFSHLQHV-KYKGQQ 200

  Fly   193 PLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPK------ELWKHFWQLR 251
            .|.....:::|......: |:.|:||||||||...|:|.||..|:.:.:      |...:|..:.
Mouse   201 VLIPGFNIEELLPESPGE-YYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMD 264

  Fly   252 DSRDQRVLNTYRELQDGHDRPVYRS 276
            |...:.::|.:|::|...:|.||.|
Mouse   265 DPTPREMINNFRQVQKFDERLVYIS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 70/250 (28%)
Car12XP_006511611.1 alpha_CA 39..290 CDD:381753 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.