DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CA4

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_005257696.1 Gene:CA4 / 762 HGNCID:1375 Length:336 Species:Homo sapiens


Alignment Length:315 Identity:91/315 - (28%)
Similarity:139/315 - (44%) Gaps:50/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVARSFAPINSGTRSHFGFNYDKQGRD--------WNVKC-GERQSPIALWSCNA-ITCNVPKLK 57
            |:|.|.|..::...||:.:....:..:        |...| .:|||||.:.:..| :...:.:..
Human     7 LLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFF 71

  Fly    58 FLNYHKSLCDPLSVINNGLTVLMRIPKTVD---GSRPSLCISTEGQQVFEADQLHFHWGSALSKG 119
            |..|.|.  ...:|.|||.:|:|.:.....   |..|:         .::|.|||.||.....||
Human    72 FSGYDKK--QTWTVQNNGHSVMMLLENKASISGGGLPA---------PYQAKQLHLHWSDLPYKG 125

  Fly   120 SEHCLDGNYYDGEVHIVH--KNASYKSNKEAGLQPNGFAVLALFI--------------RNLEDP 168
            |||.|||.::..|:||||  :..:.::.|||....:..||||..:              |..:||
Human   126 SEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEIGRMNWPPPLAPCRLSQDP 190

  Fly   169 NIETPA-------MNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAE 226
            ::...|       ...:.:.:|:|.|.:.|..:.:|..|..|......:.||.|.||||||.|.|
Human   191 SLPFQAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDE 255

  Fly   227 AVIWFVFPTPLDVPKELWKHFWQ-LRDSRDQRV--LNTYRELQDGHDRPVYRSKA 278
            .|:|.||..|:.:.:|....|.| |...::|.|  .:..|.||....|.|.:|.|
Human   256 KVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 80/268 (30%)
CA4XP_005257696.1 alpha_CA_IV_XV_like 48..307 CDD:239391 81/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.