DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca5b

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:269 Identity:77/269 - (28%)
Similarity:118/269 - (43%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GERQSPIALWSCNAITCNVPKLKFLNYHKSLC------DP---LSVINNGLTVLMRIPKTVDGSR 90
            |.|||||.:           :::...:|..|.      ||   |.:.|||.:..:....:.|.| 
 Frog    63 GSRQSPINI-----------RIRDSVFHPQLAPVHTQYDPNTCLYIWNNGYSFFVEYDDSTDKS- 115

  Fly    91 PSLCISTEG---QQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNAS-YKSNKEAGLQ 151
                 :..|   :..|...|.|||||.....||||.:|...:..|:|:||.|.| |::.:||.::
 Frog   116 -----TVSGGPLENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPAELHLVHWNCSKYRTFEEAIME 175

  Fly   152 PNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDL---FASIDSQ--- 210
            |||.||:.:|::              :.|....:.||.|..|   |:..:|.   |...||.   
 Frog   176 PNGLAVIGVFLK--------------VGKHHEKLQKLVDILP---SVRYKDALTEFNYFDSSCLL 223

  Fly   211 ----KYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLR----DSRDQRVLNTYRELQD 267
                .|:||.|||||||..|:|.|.:...|::|.......|..|.    ...::.:::.:|.||.
 Frog   224 PSCGDYWTYSGSLTTPPLTESVTWIIMKKPIEVDHSQLAVFRSLLFTAVGEEERYMVDNFRPLQP 288

  Fly   268 GHDRPVYRS 276
            ..:|.|:.|
 Frog   289 LMNRTVHSS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 75/265 (28%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.