DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CA10

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001076002.1 Gene:CA10 / 56934 HGNCID:1369 Length:328 Species:Homo sapiens


Alignment Length:286 Identity:74/286 - (25%)
Similarity:131/286 - (45%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVARSFAPINSGTRSHFGFNYDKQGRDWNV-KCGERQSPIALWSCNAITCNVPKLKFLNYHKSLC 66
            :|..||.|:    .|.:|.    ....||: ..|:||||:     |..|.::....||.      
Human    38 VVQGSFVPV----PSFWGL----VNSAWNLCSVGKRQSPV-----NIETSHMIFDPFLT------ 83

  Fly    67 DPLSVINNGLTVLMRIPKTVDGSRPSLCISTE-------GQQVF--EADQLHFHWGSALSKGSEH 122
             ||.:...|..|...:..|  |...||.:..|       |...:  ..:::..|:||..|:||||
Human    84 -PLRINTGGRKVSGTMYNT--GRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEH 145

  Fly   123 CLDGNYYDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQ--VSS 184
            .|:|..:.|||.::|.|.. |.:..||...|||..|:::||:..:..|   |.:|.:..:  ::.
Human   146 LLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSN---PFLNRMLNRDTITR 207

  Fly   185 ITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQ 249
            ||..:|:..|: .:.:::|:.  ::..:.||.||:|.|||.|...|.:...|:.:.:........
Human   208 ITYKNDAYLLQ-GLNIEELYP--ETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRL 269

  Fly   250 LRDSRDQRVL----NTYRELQDGHDR 271
            |..::..::.    :.:|.:|..::|
Human   270 LSQNQPSQIFLSMSDNFRPVQPLNNR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 66/253 (26%)
CA10NP_001076002.1 alpha_CARP_X_XI_like 46..302 CDD:239395 70/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.