DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca10b

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_005164153.1 Gene:ca10b / 568543 ZFINID:ZDB-GENE-080815-2 Length:326 Species:Danio rerio


Alignment Length:327 Identity:83/327 - (25%)
Similarity:139/327 - (42%) Gaps:98/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVARSFAPINSGTRSHFGFNYDKQGRDWNVKC--GERQSPIALWSCNAITCNVPKLKFLNYHKSL 65
            :|..||.|:    .|.:|.    ....||: |  |:||||:     |..|..:....|||     
Zfish    37 VVQGSFIPV----PSFWGL----VNTAWNL-CAIGKRQSPV-----NIETSRMIFDPFLN----- 82

  Fly    66 CDPL-----------SVINNGLTVLMRIPKT--VDGSRPSLCISTEGQQVFEADQLHFHWGSALS 117
              ||           ::.|.|..|.:|..|:  |:.|...|..|      :..:::..|:||..:
Zfish    83 --PLRLNAGQRKVSGTMYNTGRHVSLRPDKSHLVNISGGPLSYS------YRLEEIRLHFGSEDN 139

  Fly   118 KGSEHCLDGNYYDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQ 181
            :||||.|:|..:.|||.::|.|.. |.:..:|...|||.||:::|::..|..|:   .:|.:..:
Zfish   140 RGSEHLLNGQAFPGEVQLIHYNQDLYLNYSDAVRSPNGIAVVSIFMKISEPTNV---FLNRMLNR 201

  Fly   182 --VSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDV----- 239
              |:.||...|:..|. .:.:::|:.  ::.::.||:||:|.|||.|...|.:...|:.:     
Zfish   202 ETVTRITYKHDAYLLM-GLNIEELYP--ETSRFITYEGSITIPPCLETATWILMNKPIYISQIEM 263

  Fly   240 ----------PKELWK---------------------HFWQLRDSRDQRVLNTYRELQDGHDRPV 273
                      |.:::.                     :|.|.||..:.|:|           ||.
Zfish   264 QSLRLLSQNQPSQIFLSMGDNMRPTQTLHQRCIRTNINFSQRRDCPNNRML-----------RPQ 317

  Fly   274 YR 275
            ||
Zfish   318 YR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 72/290 (25%)
ca10bXP_005164153.1 PLN02179 7..257 CDD:177835 72/252 (29%)
alpha_CARP_X_XI_like 45..301 CDD:239395 69/288 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.