DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca14

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001315073.1 Gene:ca14 / 567897 ZFINID:ZDB-GENE-051030-57 Length:373 Species:Danio rerio


Alignment Length:258 Identity:84/258 - (32%)
Similarity:120/258 - (46%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KCGE-RQSPIALWSCNAITCNVPKL---KFLNYHKSLCDPLSVINNGLTVLMRIPKTVD-GSRPS 92
            :||. .|||:.:.:..  |.:.|.|   :.:.|::....|..:.|||.||.|.:|..:. |..||
Zfish    43 ECGGFNQSPVNVDTSQ--TLHDPTLIPVQPMGYNQPGRRPFILSNNGHTVQMTLPHWMGVGGLPS 105

  Fly    93 LCISTEGQQVFEADQLHFHWGS--ALSKGSEHCLDGNYYDGEVHIVHKNAS-YKSNKEAGLQPNG 154
                     .:.|.|||.|||:  .::.||||.::|.....|:||||.|.. |.:..||.:|.||
Zfish   106 ---------HYSAVQLHLHWGNGVGIATGSEHTINGQSTSAELHIVHYNTEVYANLSEAMMQKNG 161

  Fly   155 FAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSL 219
            .|||.:.|...|:.|   .|...|...:..|........: .|..||.|.....|| ||.|.|||
Zfish   162 LAVLGILIETGEEVN---QAYGSIFNYLGRIRYAGQKVAI-PSFDLQSLLPENLSQ-YFRYNGSL 221

  Fly   220 TTPPCAEAVIWFVFPTPLDVP-KELWKHFWQLRDSRDQR-----VLNTYRELQDGHDRPVYRS 276
            |||||.|:|:|.:|...:.:. .:|.|....|..|:.:.     :.:.||..|..:.|.|..|
Zfish   222 TTPPCHESVLWTIFNERVKISHSQLLKLETVLYSSKAEEEEPTILQDNYRATQPLNHRTVLSS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 81/252 (32%)
ca14NP_001315073.1 alpha_CA 33..285 CDD:294017 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.