DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ptprga

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001316793.1 Gene:ptprga / 561197 ZFINID:ZDB-GENE-101101-4 Length:1414 Species:Danio rerio


Alignment Length:262 Identity:73/262 - (27%)
Similarity:126/262 - (48%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KCGER-QSPIALWSCNA-ITCNVPKLKFLNYHKSLCDPLSVINNGLTV--LMRIPKTVDGSRPSL 93
            :|.|| ||||.:...:. ::....:|....:.....:..|:.|.|.||  .::....|.|:    
Zfish    77 ECQERNQSPINIADQDTKVSMEYQELTLDGFDAESSNKTSMKNTGKTVAIFLKDDYFVRGA---- 137

  Fly    94 CISTEGQQVFEADQLHFHWG-SALSKGSEHCLDGNYYDGEVHI-VHKNASYKSNKEAGLQPNGFA 156
              ...|:  |:|:::.|||| |..|.||||.::|..:..|:.| ::.:..:.|...|..:....|
Zfish   138 --GLPGR--FKAEKVEFHWGQSNGSDGSEHSINGRRFPVEMQIFMYNSDDFDSLNTAIREKRVIA 198

  Fly   157 VLALFIR-NLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLF-ASIDSQKYFTYQGSL 219
            .:|:|.: :.:|    .||::.|...:..:...:....|| ...|:||. :||.|  |:.|.|||
Zfish   199 AMAVFFQVDFKD----NPAVDPIIHGLRGVVHHEKETFLE-PFVLRDLLPSSIGS--YYRYIGSL 256

  Fly   220 TTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQ-------RVLNTYRELQDGHDRPVYRSK 277
            |||||::.|.|.||..|:.:..:..:.|:.:..:..|       .:.|.:|.||...:|.|::|.
Zfish   257 TTPPCSKVVEWIVFSRPVLLSYKQLEAFYSIFTTEQQDHVKSVEYLRNNFRPLQSLDNREVFKSA 321

  Fly   278 AK 279
            .|
Zfish   322 VK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 69/253 (27%)
ptprgaNP_001316793.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.