DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CAH16

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster


Alignment Length:288 Identity:100/288 - (34%)
Similarity:153/288 - (53%) Gaps:25/288 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVARSFAPINSGTRSHFGFNYDKQGRDWNVKC--GERQSPIALWSCNAITCNVPKLKFLNYHK 63
            :.|:..:|....:|..    :||.|.|:||...|  |:.||||.|.|..|....:|.:.|.:|::
  Fly    10 LLLLPLAFYQSTNGME----WNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYR 70

  Fly    64 SLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEGQQV--FEADQLHFHWGSALSKGSEHCLDG 126
            .|..|..:.|||.::.:.||.|.:|.:|.:   |.|:..  :.||.|||||||..|:||||.::.
  Fly    71 LLKRPFYIRNNGHSISLDIPVTSNGRKPFI---TGGRLKGRYYADGLHFHWGSYKSRGSEHLINK 132

  Fly   127 NYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDS 191
            ..:|.|:||||:|..|::..:|..|.:|.||:|:.:..:...|.::..::.:.:.|..:      
  Fly   133 RRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRV------ 191

  Fly   192 CPLEDSMA-------LQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQ 249
             |:|||.|       |..|...:..:.:|||:||||||.|.|.|.|.||.....|.......||.
  Fly   192 -PIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWL 255

  Fly   250 LRDSRDQRVLNTYRELQDGHDRPVYRSK 277
            |||....|::|.||.:||.::|.|:..|
  Fly   256 LRDHWGHRLINNYRIVQDLNNRTVFYKK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 88/247 (36%)
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 94/261 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446779
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm6335
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.900

Return to query results.
Submit another query.