DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Ca13

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:262 Identity:77/262 - (29%)
Similarity:108/262 - (41%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SHFGFNYDKQGR--DWN----VKCGERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNG 75
            :...:.||:...  .||    :..|::||||.:           |.|.:.|..|| .|||:..:.
  Rat     2 ARLSWGYDEHNGPIHWNELFPIADGDQQSPIEI-----------KTKEVKYDSSL-RPLSIKYDP 54

  Fly    76 LTVLMRIPKTVDGSRPSLCI---STEGQQV---------FEADQLHFHWGSALSKGSEHCLDGNY 128
            .:.     |.:..|..|..:   .||.:.|         :...|.|.|||||...||||.:||..
  Rat    55 ASA-----KIISNSGHSFNVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVR 114

  Fly   129 YDGEVHIVHKNA-SYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSI------- 185
            |..|:|:||.|: .|.|..||..:.:|.|||.:|::..|    ..|.:..|...:.||       
  Rat   115 YAAELHVVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGE----HNPQLQKITDILDSIKEKGKQT 175

  Fly   186 --TKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFW 248
              |..|..|.|..|.            .|:||.||||.||..|:|.|.|...|:.:..:....|.
  Rat   176 RFTNFDPLCLLPSSW------------DYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFR 228

  Fly   249 QL 250
            .|
  Rat   229 SL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 73/238 (31%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 77/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.