DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca8

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:291 Identity:75/291 - (25%)
Similarity:134/291 - (46%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTRSHFGFNYDKQGRDWNV----KCGERQSPIALWSCNAITCNVPKLKFLNYHKSL--------- 65
            |.:.:..:.|: :|.:|.:    ..|:.||||.:.|..|:           |..||         
 Frog    14 GEKENQEWGYE-EGVEWGLLYPEANGDYQSPININSREAM-----------YDPSLLEVRLTPSY 66

  Fly    66 --CDPLSVINNG--LTVLMRIPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDG 126
              |....|||:|  :.:|::....:.|..     ...|.: :|.:::.||||....:||||.::.
 Frog    67 VVCRDCEVINDGHVVQILLKSKSVLKGGP-----LPRGHE-YELNEVRFHWGKENQRGSEHTVNF 125

  Fly   127 NYYDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQV------SS 184
            ..:..|:|::|.|:: |:|.:||..:.:|..:::||:: :...||...|:..:.:.:      .:
 Frog   126 KAFPMELHLIHWNSTLYRSLEEAMGKVHGIVIISLFVQ-IGKENIGLKAITEVLQDIFYKGKSKT 189

  Fly   185 ITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQ 249
            |...:.:..|.|.: |:|         |:.|:||||.|||:|.|.|.:|..||.|.:...:.|.:
 Frog   190 IPCFNPNTLLPDPL-LRD---------YWVYEGSLTMPPCSEGVTWILFRYPLTVSQTQIEEFRR 244

  Fly   250 LR---------DSRDQRVLNTYRELQDGHDR 271
            ||         |..|..:.:.:|..|...||
 Frog   245 LRTHIKGADLPDGCDGLMADNFRPTQPLSDR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 71/266 (27%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 73/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.