DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CAH6

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:262 Identity:94/262 - (35%)
Similarity:157/262 - (59%) Gaps:9/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SHFGFNYDKQGRDWNVKC--GERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVL 79
            ||  ::|:..|::|...|  |||||||:|....::...:|::.|.||...|..||:::|||.|..
  Fly    28 SH--WDYETNGQNWGGICSTGERQSPISLNVQKSLIVPLPRIVFGNYDVKLRGPLTLLNNGHTAH 90

  Fly    80 MRIPKTVDGSRPSLCISTEG--QQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASY 142
            :.||:|.:|::|.:   |.|  :..|.|:..||||||..|:||||.::...:|.|:||||:|..|
  Fly    91 VEIPETANGNKPFI---TGGLLKGRFVAEAFHFHWGSPSSRGSEHSINQQRFDVEMHIVHRNEKY 152

  Fly   143 KSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASI 207
            ....||..:.:|.||:.:.::.:::||...|.::.:...:..:||.:....:...::|..:..::
  Fly   153 GDIDEAKNKKDGIAVIGVMLKIVKNPNRIFPGLSKVMSALPRVTKYNAKTTIPGGLSLGQMLGNV 217

  Fly   208 DSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDRP 272
            :.:.:|||:||||||.|.::|.|.||...|.||......||:||||...|::|.:|::|..:.||
  Fly   218 NPRDFFTYRGSLTTPLCEQSVTWTVFSQVLPVPYSSVSKFWKLRDSEGHRLINNFRDIQPRNGRP 282

  Fly   273 VY 274
            |:
  Fly   283 VF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 87/240 (36%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 89/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446777
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm6335
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.900

Return to query results.
Submit another query.