DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CAH8

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001262833.1 Gene:CAH8 / 42625 FlyBaseID:FBgn0038956 Length:303 Species:Drosophila melanogaster


Alignment Length:286 Identity:100/286 - (34%)
Similarity:153/286 - (53%) Gaps:27/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVARSFAPINSGTRSHFGFNYDKQGRDWNVK---C-GERQSPIALWSCNAITCNVPKLKFLNY 61
            :||:     |..:..|| ..|:| |....|..|   | |..|||||:....||..|:|.|.|..|
  Fly    14 LFLL-----PFAANFRS-TDFDY-KSPERWPEKYPNCGGSEQSPIAISRRKAIPLNLPPLIFALY 71

  Fly    62 HKSLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEG--QQVFEADQLHFHWGSALSKGSEHCL 124
            .:...:.:::.|:|.||..::|.|:.|.:|.:   |.|  :..::|:.:||||||..||||||.|
  Fly    72 DEFFDELVTIRNSGHTVEFKVPTTIYGVKPYV---TGGLLRDCYDAEAVHFHWGSPESKGSEHLL 133

  Fly   125 DGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLED-PNIETPAMNMICKQVSSITKL 188
            :|..:|.|:||||:|..|.:.:||....:|..|||:..:.:.. |....|.::.|...:..:...
  Fly   134 NGRRFDLEMHIVHRNTKYLNLEEAVKYSDGVTVLAVLFKVVRSGPFFYQPGLSEIFSSLLHLGNF 198

  Fly   189 DDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPL-----DVPKELWKHFW 248
            :.|..:::.:.|..|..|:|...::||:||||||||:..|.|.||...|     |:||     ||
  Fly   199 NASYTVQERLTLGSLLGSLDRGNFYTYKGSLTTPPCSPVVQWHVFGEVLPISHQDLPK-----FW 258

  Fly   249 QLRDSRDQRVLNTYRELQDGHDRPVY 274
            .|||.|.:.:|..:|.||...:|.::
  Fly   259 NLRDERGRPLLKNFRPLQSQENRLIF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 89/246 (36%)
CAH8NP_001262833.1 Carb_anhydrase 31..281 CDD:215000 92/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446780
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm6335
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.900

Return to query results.
Submit another query.