DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CAH7

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:138/293 - (47%) Gaps:44/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVARSF---APINSGTRSHFGF-----NYDKQGRDWNVKC--GERQSPIALWSCNAITCNVPK 55
            |.|:|.|.   ..::....:.:|:     |.|:....|...|  |::||||.|....|:......
  Fly     1 MHLIALSLIVCCSVSFSWANEWGYPDLDNNQDEPFPKWGGLCDSGKKQSPINLHVKGALKGEFDA 65

  Fly    56 LKFLNY--HKSLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEG-QQVFEADQLHFHWGSALS 117
            |||.||  |:.   .|.::|||.::      .:.|....|.:|... .|.|..:|:|.||     
  Fly    66 LKFENYDEHQK---NLRMVNNGHSI------QLSGFDHELTLSGGALLQDFVVEQIHMHW----- 116

  Fly   118 KGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQV 182
             .|||.::...|..||||||:|..|.:...|....:|..|:.:.......||   .|:..|.|.:
  Fly   117 -WSEHTINDIRYPLEVHIVHRNTIYPNMTMAANFKDGIVVIGVLYHVSNTPN---EAIGSIIKSL 177

  Fly   183 SSITKLDD-SCP--LEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFV----FPTPLDVP 240
            .::...|. :.|  :.||:|:.||..|:::  ||||.||||||.|||||.|.|    ||..||..
  Fly   178 GAVKSYDSMNKPVLVADSLAVDDLVPSVEN--YFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQV 240

  Fly   241 KELWKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
            .|    |.::.....:::.|.|||||..::|.|
  Fly   241 NE----FKEIEYDEGKQLHNNYRELQSENNRAV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 85/249 (34%)
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 84/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446813
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.900

Return to query results.
Submit another query.