DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca2

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_954685.2 Gene:ca2 / 387526 ZFINID:ZDB-GENE-031219-5 Length:260 Species:Danio rerio


Alignment Length:275 Identity:88/275 - (32%)
Similarity:121/275 - (44%) Gaps:36/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HFGFNY----DKQGRDWNVKCGERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTV 78
            |:|::.    ||.|..:.:..|.|||||.:.|  :.|....||..|.........|.:.|||.:.
Zfish     4 HWGYDKHNGPDKWGESYPIANGSRQSPIDIKS--STTTYDEKLTPLKLKYDPSTSLDIQNNGHSF 66

  Fly    79 LMRIPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYK 143
            .:..   ||....|..........|...|.|||||||..|||||.::|..|..|:|:||.|..|.
Zfish    67 QVSF---VDDQNSSTLTGGPVTGTFRLKQFHFHWGSADDKGSEHTVNGKCYPAELHLVHWNTKYP 128

  Fly   144 SNKEAGLQPNGFAVLALFIR-NLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASI 207
            |.|:|..:|:|.||:.:|:: ..::|.::               |:.|:.....|...|..|.:.
Zfish   129 SFKDAVDKPDGLAVVGVFLKIGADNPKLQ---------------KILDAMDAIKSKGKQTPFPNF 178

  Fly   208 D-------SQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQR----VLNT 261
            |       |..|:||.|||||||..|:|.|.|....:.|.....|.|..|..|.|..    ::|.
Zfish   179 DPSVLLPSSLDYWTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNN 243

  Fly   262 YRELQDGHDRPVYRS 276
            ||..|....|.|..|
Zfish   244 YRPPQPLKGRVVRAS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 81/250 (32%)
ca2NP_954685.2 alpha_CA 1..259 CDD:320708 88/275 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.