DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CAH15

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster


Alignment Length:271 Identity:64/271 - (23%)
Similarity:122/271 - (45%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GTRSHFGFNYDKQGRDWNVKCGERQSPIALWSCNAITCNVPKLKFL-NYHKSLCDPLSVINNGLT 77
            |:...:.:::|:....|:..| ..||||.: ..|.:..|......: :::.|:...:.:.|||.|
  Fly    77 GSPESYNYDWDQGPHTWDTAC-NNQSPINI-DMNCVEINYFDTPLIWSHYNSIPLGIRLENNGHT 139

  Fly    78 VLMRIPKTVDGSRPSLCISTEGQQV---FEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKN 139
            :::|      .:.|....|.:|..:   |:..::.|.|..|.|.||||.||.::...|:..:|.:
  Fly   140 LILR------AAFPERTPSIDGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTD 198

  Fly   140 ASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSIT---KLDDSCPLEDSMALQ 201
            ..       |......:...|.|..:.|.:...|.::::.:.::::.   ::.:..|...|..:.
  Fly   199 GD-------GCDGCSSSQGVLMISYMFDLSEHNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMS 256

  Fly   202 DLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQ 266
            ..:     .|:::|.||||.|||.....|.::|..|.:.:.....|.||||.|..|:....|.:|
  Fly   257 PFY-----DKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQLRDRRGSRIARNARPVQ 316

  Fly   267 DGHDRPVYRSK 277
            ...||.||.::
  Fly   317 PIGDRMVYLNR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 58/245 (24%)
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 62/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446815
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.