DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Ca12

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:285 Identity:82/285 - (28%)
Similarity:135/285 - (47%) Gaps:33/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SFAPINSGTRSHFGFNYDKQGRDWNVK---CGE-RQSPIALWS-CNAITCNVPKLKFLNYHKSLC 66
            |.||:|....::.|...:|   :|:.|   ||. .||||.|.| ......::..|:|..|:.|:.
  Rat    23 SSAPLNGSKWTYIGPAGEK---NWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVE 84

  Fly    67 DPLSVINNGLTVLMRIPKT--VDGSRPSLCISTEGQQVFEADQLHFHWGSALS-KGSEHCLDGNY 128
            ..|::.|:|.:|.:.:...  :.|.:|         ..:.|:|||.|||:... .||||.:.|.:
  Rat    85 KLLNLTNDGHSVRLNLNSDMYIQGLQP---------HQYRAEQLHLHWGNRNDPHGSEHTVSGKH 140

  Fly   129 YDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSC 192
            :..|:||||.|:. |.....|..:..|.||||:.|    :.....|:.:.|...:..: |.....
  Rat   141 FAAELHIVHYNSDLYSDFGSASDKSEGLAVLAVLI----EIGSVNPSYDKIFSHLQHV-KYKGQQ 200

  Fly   193 PLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPK------ELWKHFWQLR 251
            .|.....:::|......: |:.|:||||||||...|:|.||..|:.:.:      |...:|..:.
  Rat   201 VLIPGFNIEELLPESPGE-YYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMD 264

  Fly   252 DSRDQRVLNTYRELQDGHDRPVYRS 276
            |...:.::|.:|::|...:|.||.|
  Rat   265 DPSPREMVNNFRQVQKFDERLVYIS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 70/250 (28%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.