DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and CAH1

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:128/260 - (49%) Gaps:44/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HFGFNYDKQGRDWNVK----CGERQSPIALWSCNA---ITCNVPKLKFL---NYHKSLCDPLSVI 72
            |:|:..:.....|..:    .|.||||:.:...:|   ...||..||:.   .:.|||.:|    
  Fly     4 HWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNP---- 64

  Fly    73 NNGLTVLMRIPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVH 137
                ....|:  .|:|:...|.....|.|:|:.:|.|.|||...||||||.:||..|.||:|:||
  Fly    65 ----GYCWRV--DVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVH 123

  Fly   138 KNAS-YKSNKEAGLQPNGFAVLALFIR----NLEDPNIETPAMNMICKQVSSITKLDDSCPLEDS 197
            .|.: |||..||...|:|.|||.:|::    :.|...: |..:..:..:...:| |...|  :..
  Fly   124 WNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKV-TSLLQFVLHKGDRVT-LPQGC--DPG 184

  Fly   198 MALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTY 262
            ..|.|:      ..|:||:||||||||:|:|||.||.||::|..:      ||...|:   ||.|
  Fly   185 QLLPDV------HTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDD------QLNAMRN---LNAY 234

  Fly   263  262
              Fly   235  234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 85/239 (36%)
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 87/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446811
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.900

Return to query results.
Submit another query.