DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Ca9

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:251 Identity:80/251 - (31%)
Similarity:124/251 - (49%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GERQSPIAL-WSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTE 98
            |..|||:.: ....:....:..|:.|.|.......||:.|||.||.:.:|       |.|.:...
  Rat   137 GRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPELSLCNNGHTVQLTLP-------PGLKMVLG 194

  Fly    99 GQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIR 163
            ..|.:.|.|||.|||::...||||.::|:.:..|:|:||.:.::....||..:|.|.||||.|::
  Rat   195 PGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSELHEALGRPGGLAVLAAFLQ 259

  Fly   164 NLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASI----DSQKYFTYQGSLTTPPC 224
                   |:|..|...:|:  ::.|::.......:.:..|..|.    |..:|:.|:||||||||
  Rat   260 -------ESPEENSAYEQL--LSHLEEIAEEGSKIEIPGLDVSALLPSDLSRYYRYEGSLTTPPC 315

  Fly   225 AEAVIWFVFPTPLDVPKE----LWKHFWQLRDSRDQRVLNTYRELQDGHDRPVYRS 276
            ::.|||.||...:.:..:    |....|.|||||.|  || :|..|..:.|.:..|
  Rat   316 SQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRLQ--LN-FRATQPLNGRTIEAS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 79/247 (32%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.