DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Ca6

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001128313.1 Gene:Ca6 / 298657 RGDID:70516 Length:312 Species:Rattus norvegicus


Alignment Length:248 Identity:81/248 - (32%)
Similarity:130/248 - (52%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GERQSPIALWSCNA-ITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMRIPKTV-----DGSRPSL 93
            |||||||.:..... .:.::..|..:||.:...: ||:.|||.||.:.:|.|:     ||:    
  Rat    43 GERQSPIDVKRREVHFSSSLLPLHMVNYEEEGLE-LSMTNNGHTVQITLPNTMSMRDSDGT---- 102

  Fly    94 CISTEGQQVFEADQLHFHWGSALSK--GSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFA 156
                    |:...|:|||||...|:  ||||.:||..:..|:|:||.|..|::.::|..||:|.|
  Rat   103 --------VYRTKQMHFHWGGRDSEISGSEHTIDGMRHAIEIHLVHFNEKYETYEKAVDQPDGLA 159

  Fly   157 VLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTT 221
            |:|:.:: :|| ..|....:....::.::.....:..|. ::.::::... |.:.|:||||||||
  Rat   160 VMAVLVK-VED-YTENDYYSTFISELENVKYTGQTTTLR-NVNIRNMLPG-DIRHYYTYQGSLTT 220

  Fly   222 PPCAEAVIWFVFPTPLDVPKELWKHFWQ-LRDSRDQRVLNTYRELQDGHDRPV 273
            |||.|.|.||||.....:.|...:.... :.|..:|.:.|.||..|..|:|.|
  Rat   221 PPCTENVKWFVFQDSATISKAQAERIENAVMDHHNQTIRNGYRRTQPLHNRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 81/248 (33%)
Ca6NP_001128313.1 alpha_CA_VI 30..278 CDD:239399 81/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.