DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Ca8

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:281 Identity:76/281 - (27%)
Similarity:129/281 - (45%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQGRDWNV----KCGERQSPIALWSCNAITCNVPKLKFLNYHKSL-----------CDPLSVINN 74
            ::|.:|.:    ..||.||||.|.|..|           .|..||           |....|.|:
  Rat    32 EEGVEWGLVFPDANGEYQSPINLNSREA-----------RYDPSLLDVRLSPNYVVCRDCEVTND 85

  Fly    75 GLTVLMRI-PKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHK 138
            |.|:.:.: .|:|....|    ..:||: ||..::.||||....:||||.::...:..|:|::|.
  Rat    86 GHTIQVILKSKSVLSGGP----LPQGQE-FELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHW 145

  Fly   139 NAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQV------SSITKLDDSCPLED 196
            |:: :.|..||..:|:|..::|||:: :...::...|:..|.:.:      .:|...:.:..|.|
  Rat   146 NSTLFGSIDEAVGKPHGIVIIALFVQ-IGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPD 209

  Fly   197 SMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLR---------D 252
            .: |:|         |:.|:||||.|||:|.|.|.:|..||.:.:...:.|.:||         :
  Rat   210 PL-LRD---------YWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVE 264

  Fly   253 SRDQRVLNTYRELQDGHDRPV 273
            ..|..:.:.:|..|...||.:
  Rat   265 GCDGILGDNFRPTQPLSDRVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 74/267 (28%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 75/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.