DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Car15

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:241 Identity:80/241 - (33%)
Similarity:108/241 - (44%) Gaps:41/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 YDKQGRDWNVKCGERQSPIALWSCNAITCNVP----------------KLK---FLNYHKSLCDP 68
            ||.|    :.|||.     |.|...|..|..|                .||   |..|..:..||
  Rat    26 YDSQ----DPKCGP-----AHWKELAPACGGPTQSPVNIDLRLVQRDYALKPFIFHGYDSAPQDP 81

  Fly    69 LSVINNGLTVLMRIPKTVDGSRPSLCISTEGQQVFEAD----QLHFHWGSALSKGSEHCLDGNYY 129
            ..:.|:|.|||:|:     .|....|.:..|..:..::    ||||||||...|||||.:|..:.
  Rat    82 WILENDGHTVLLRV-----HSCQQNCPAIRGAGLPSSEYRLLQLHFHWGSPGHKGSEHSVDEKHG 141

  Fly   130 DGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPL 194
            ..|:|:||.|..|:|...|..||:|.|:||:.:...:..|....|:....|.|||   ...|..|
  Rat   142 SMEMHMVHMNTKYQSMGHARSQPDGLAILAVLLVEEDKDNTNFSAIVSGLKNVSS---PGVSVNL 203

  Fly   195 EDSMALQDLFAS-IDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDV 239
            ..:.||..|..| :...:|:.|.||||||.|..||:|.||...:.:
  Rat   204 TSTFALASLLPSALGLLRYYRYSGSLTTPGCEPAVLWTVFENTVPI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 75/229 (33%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 70/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.