DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Car14

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_006501505.1 Gene:Car14 / 23831 MGIID:1344341 Length:460 Species:Mus musculus


Alignment Length:271 Identity:80/271 - (29%)
Similarity:133/271 - (49%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSHFGFNYDKQGRDWNVKCGERQSPIALWSCNAI-TCNVPKLKFLNYHKSLCDPLSVINNGLTVL 79
            :.|:..:|.:.|       |:.||||.:.:.:.| ..::|.::...|.:...:||.:.|||.||.
Mouse    30 QDHWPTSYPECG-------GDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQ 87

  Fly    80 MRIPKTVD-GSRPSLCISTEGQQVFEADQLHFHWGSALS-KGSEHCLDGNYYDGEVHIVHKNA-S 141
            :.:|.|:. |..|         :.:.|.|||.|||...| :||||.::......|:|:||.:: |
Mouse    88 LSLPPTLHLGGLP---------RKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQS 143

  Fly   142 YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDD--SCPLEDSMALQDLF 204
            |.|..||..:|.|.|||.:.|   |....|.||.:.|..::..|...|.  |.|   ..::::||
Mouse   144 YSSLSEAAQKPQGLAVLGILI---EVGETENPAYDHILSRLHEIRYKDQKTSVP---PFSVRELF 202

  Fly   205 ASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVP----KELWKHFWQLRDSRDQRVLNTYREL 265
            .. ..:::|.|.||||||||.::|:|.||.....:.    ::|.:......:...:.::..||..
Mouse   203 PQ-QLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVP 266

  Fly   266 QDGHDRPVYRS 276
            |..:.|.::.|
Mouse   267 QPLNQRTIFAS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 76/248 (31%)
Car14XP_006501505.1 alpha_CA_XII_XIV 29..278 CDD:239400 80/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.