DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and cah-1

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001309492.1 Gene:cah-1 / 186231 WormBaseID:WBGene00000279 Length:303 Species:Caenorhabditis elegans


Alignment Length:299 Identity:75/299 - (25%)
Similarity:127/299 - (42%) Gaps:44/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVARS--FAPINSGTRSHFGFNYDKQG---------RD-WNVKCGERQSPI------ALWSCN 47
            :||:..:  .:|:.|.....:.::.|..|         :| |..|.|..||||      .|:..:
 Worm    10 LFLIILTCHISPLKSSQNYQWSYDSDVFGGPHFWGLVEKDWWMCKKGRLQSPIDIQPDRLLFDAS 74

  Fly    48 AITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMRIPKTVDGSRPSLCISTEGQQV---FEADQLH 109
            .....:.||..::         ..:|.|..|.:||  .....:||:.| |.|...   :...::.
 Worm    75 VKPVRLDKLPVVS---------EFVNTGQMVRVRI--GYSSKKPSVNI-TSGPLYGYRYRVQRID 127

  Fly   110 FHWGSALSKGSEHCLDGNYYDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETP 173
            ||.|.....||||.::|..:..||.:|..|.. |.:...|...|:|.|:|::.:....:.|.|..
 Worm   128 FHMGRKNENGSEHTINGRRFPMEVQLVAYNTDLYPNFTSASKSPHGIAILSVLVDFGPETNQELI 192

  Fly   174 AMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLD 238
            .:.:   ..:||:..|....|.|....:.|..:.|   ..||:||||:|.|.|.|.|.:...|:.
 Worm   193 KLTI---ATASISYKDQRVQLADFEPWRLLPFTRD---IITYEGSLTSPGCHETVTWIILNQPIF 251

  Fly   239 VPK---ELWKHFW-QLRDSRDQRVLNTYRELQDGHDRPV 273
            :.|   |.|.|.: .:..:....|...:|::|:.::|.|
 Worm   252 IKKEHFEEWSHLYLSMEGAEKVPVAPNFRKIQETNNRLV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 66/253 (26%)
cah-1NP_001309492.1 alpha_CARP_X_XI_like 39..295 CDD:239395 69/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.