DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and cah-4

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_510265.1 Gene:cah-4 / 181478 WormBaseID:WBGene00000282 Length:280 Species:Caenorhabditis elegans


Alignment Length:267 Identity:76/267 - (28%)
Similarity:115/267 - (43%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQGRDWNVKCGERQSPIAL----WSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMR---- 81
            |..:.:.....:|||||.:    ..|:...|....|. ::|....|..:.|...|..|.::    
 Worm    39 KSNKKFKKAAAQRQSPIDIVPQHVCCDTDVCKADALN-IDYKSGDCCDVLVSEGGFLVNVKRNCG 102

  Fly    82 -------IPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKN 139
                   :|.:                .|...|.|.||||...:||||.|||....||||.|..|
 Worm   103 TFLTANHLPSS----------------KFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWN 151

  Fly   140 ASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLF 204
            .||:|...|..:|:|.||:.:|::..:..:.....::.:.|...:.|.:    .:.....::.|.
 Worm   152 TSYESFNVALSKPDGLAVVGVFLKEGKYNDNYHGLIDTVRKATGNATPI----AMPKDFHIEHLL 212

  Fly   205 ASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGH 269
            .|.|.:::.||.|||||||..|.|||.:|..|::|      .|.||...|:....| :|..||..
 Worm   213 PSPDKREFVTYLGSLTTPPYNECVIWTLFTEPVEV------SFGQLNVLRNIIPAN-HRACQDRC 270

  Fly   270 DRPVYRS 276
            ||.:..|
 Worm   271 DREIRSS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 74/253 (29%)
cah-4NP_510265.1 alpha_CA 50..275 CDD:238200 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.