DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and cah-5

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_509186.3 Gene:cah-5 / 180972 WormBaseID:WBGene00000283 Length:310 Species:Caenorhabditis elegans


Alignment Length:278 Identity:77/278 - (27%)
Similarity:131/278 - (47%) Gaps:29/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 INSGTRSHFGFNYDK-QGRD-WNVKCGE--RQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSV 71
            ::.|..|..|:.||: .|.| |..||..  :||||.:.:.:.....:.::.||||  .:...:.:
 Worm    18 VSCGPGSDHGWGYDENNGPDTWQGKCQNHLKQSPIDIRAPDVDYALLHRMHFLNY--DMDGKIEL 80

  Fly    72 INNGLTVLMRIPKTVDGSRPSLCISTEG---QQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEV 133
            .|.|.|:.....::....:|.:    :|   :..::..|.|.|||...:.||||.:...:|..|:
 Worm    81 SNTGRTLFAGGFESWQHKQPMI----QGGGLKHRYKLAQFHLHWGQNDAVGSEHAMGSLHYPAEL 141

  Fly   134 HIVHKNASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSIT-KLDDSCPLEDS 197
            |:||..... :.|||..:|:|.||:.:|:....||         :..:.|.|: :|.|.....:.
 Worm   142 HLVHVREGL-TLKEALSRPDGLAVVGVFLAKTNDP---------VANKFSPISERLHDLRHSGNK 196

  Fly   198 MALQDL----FASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRV 258
            ..|::.    ...:|::.::.|:||||||.|:|||||.|...|:.:.........||.:....:.
 Worm   197 TELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISSHQLHLLRQLHNKELVKS 261

  Fly   259 LNTYRELQDGHDRPV-YR 275
            ...||.||..:.|.: ||
 Worm   262 DKNYRPLQPLNGRRIQYR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 65/249 (26%)
cah-5NP_509186.3 Carb_anhydrase 28..275 CDD:215000 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I3256
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I3186
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.