DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and cah-5

DIOPT Version :10

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_509186.3 Gene:cah-5 / 180972 WormBaseID:WBGene00000283 Length:310 Species:Caenorhabditis elegans


Alignment Length:72 Identity:16/72 - (22%)
Similarity:35/72 - (48%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YYPSSAGDINGSVPPMKEAAFDEWSKHRLPQHSYSITDGSEKLADLKMGA--SKSPAVAVLAA-- 69
            ||.:.|....|.:.|:   |.:...|.:....:|.|...:.::|.:|:.|  ::...:::|::  
 Worm    25 YYGNEADPETGKLIPI---AVEGIIKCKSGGKTYPIQGATARIACVKVDAYGNELVPISILSSKT 86

  Fly    70 -LKGTFL 75
             .||.|:
 Worm    87 DAKGYFI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 9/46 (20%)
cah-5NP_509186.3 Carb_anhydrase 28..275 CDD:215000 14/69 (20%)

Return to query results.
Submit another query.