DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and cah-2

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_495567.3 Gene:cah-2 / 174218 WormBaseID:WBGene00000280 Length:337 Species:Caenorhabditis elegans


Alignment Length:267 Identity:61/267 - (22%)
Similarity:113/267 - (42%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DWNV-KCGERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVLM----RIP-KTVD 87
            ||.: ..|:.|||:          |:...:.| |...|. |:::..|.:..:.    ::| .||.
 Worm    26 DWRMCTAGQMQSPV----------NIDPSQLL-YDPHLM-PINIEGNIVEAVFENTGQLPVVTVK 78

  Fly    88 G--SRPSLCISTEGQQV---FEADQLHFHWGSA--LSKGSEHCLDGNYYDGEVHIV-HKNASYKS 144
            .  :||::.| |.|..:   ::..|:..|:|.|  ..|||||.:|...:..|:.:: :.:|.|.:
 Worm    79 DLPNRPTINI-TGGPTMPYRYKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQLLAYNSALYPN 142

  Fly   145 NKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVS---SITKLDDSCPLEDSMALQDLFAS 206
            ...|...|.|...:::.:...:..::|...:.:..:.::   ..|.|.|..|   |..|.     
 Worm   143 FSVAMTSPRGLLAVSVIVDIGKTTSVELRRLTVASQSINYKGQTTNLTDFQP---SALLP----- 199

  Fly   207 IDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDR 271
             .:..|.||:||||.|.|.|.|.|.:...|:.:..:            |.::.|..::.:.....
 Worm   200 -KTSHYVTYEGSLTFPGCHETVTWVILNNPIYITND------------DLQIWNEMQKTETKQPE 251

  Fly   272 PVYRSKA 278
            |.|.:.|
 Worm   252 PSYMTPA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 57/254 (22%)
cah-2NP_495567.3 alpha_CARP_X_XI_like 16..275 CDD:239395 61/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.