DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Ptprg

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:263 Identity:72/263 - (27%)
Similarity:120/263 - (45%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NVKC-GERQSPIALWSCNA-ITCNVPKLKFLNYHKSLCDPLSVINNGLTV--LMRIPKTVDGSRP 91
            :|.| |..||||.:...:| :.....:|:...:.....:...:.|.|.||  |::....|.|:  
  Rat    75 SVSCGGSHQSPIDILDHHARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGA-- 137

  Fly    92 SLCISTEGQQVFEADQLHFHWG-SALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNG- 154
                ...|:  |:|:::.|||| |..|.||||.::|..:..|:.|...|.....:.:..:..|. 
  Rat   138 ----GLPGR--FKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYNPDDFDSFQTAISENRI 196

  Fly   155 FAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLF-ASIDSQKYFTYQGS 218
            ...:|:|.:  ..|. :..|::.|...:..:...:....| |...|:||. ||:.|  |:.|.||
  Rat   197 IGAMAIFFQ--VSPR-DNSALDPIIHGLKGVVHHEKETFL-DPFVLRDLLPASLGS--YYRYTGS 255

  Fly   219 LTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQ-------RVLNTYRELQDGHDRPVYRS 276
            ||||||:|.|.|.||..|:.:.....:.|:.:..:..|       .:.|.:|..|..:||.|.:|
  Rat   256 LTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQALNDRVVSKS 320

  Fly   277 KAK 279
            ..:
  Rat   321 AVR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 68/251 (27%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 71/257 (28%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.