DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Car11

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:258 Identity:70/258 - (27%)
Similarity:119/258 - (46%) Gaps:39/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WNVKC--GERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMRIPKT------V 86
            |:: |  |:||||:.:           :||.:.|...| .||.:...|..:...:..|      :
Mouse    59 WSL-CAVGKRQSPVDV-----------ELKRVLYDPFL-PPLRLSTGGEKLRGTLYNTGRHVSFL 110

  Fly    87 DGSRPSLCISTEGQQVF--EADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAG 149
            ..|||.:.:| .|..::  ...:|...:|:....||||.::...:..||.::|.|.....|..|.
Mouse   111 PASRPVVNVS-GGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLIHFNQELYGNLSAA 174

  Fly   150 LQ-PNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASI---DSQ 210
            .: |||.|:|:||:......|   |.::.:..: .:||::...   .|:..||||...:   :|.
Mouse   175 SRGPNGLAILSLFVNVAGSSN---PFLSRLLNR-DTITRISYK---NDAYFLQDLSLELLFPESF 232

  Fly   211 KYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
            .:.||||||:||||:|.|.|.:....|:: ..|..|..:|........:  ::.| .|:.||:
Mouse   233 GFITYQGSLSTPPCSETVTWILIDRALNI-TSLQMHSLRLLSQNPPSQI--FQSL-SGNGRPL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 68/251 (27%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.