DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Car8

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_031618.2 Gene:Car8 / 12319 MGIID:88253 Length:291 Species:Mus musculus


Alignment Length:281 Identity:77/281 - (27%)
Similarity:130/281 - (46%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KQGRDWNV----KCGERQSPIALWSCNAITCNVPKLKFLNYHKSL-----------CDPLSVINN 74
            ::|.:|.:    ..||.||||.|.|..|           .|..||           |....|.|:
Mouse    33 EEGVEWGLVFPDANGEYQSPINLNSREA-----------RYDPSLLDVRLSPNYVVCRDCEVTND 86

  Fly    75 GLTVLMRI-PKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHK 138
            |.|:.:.: .|:|....|    ..:||: ||..::.||||....:||||.::...:..|:|::|.
Mouse    87 GHTIQVILKSKSVLSGGP----LPQGQE-FELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHW 146

  Fly   139 NAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQV------SSITKLDDSCPLED 196
            |:: :.|..||..:|:|.|::|||:: :...::...|:..|.:.:      .:|...:.:..|.|
Mouse   147 NSTLFGSIDEAVGKPHGIAIIALFVQ-IGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPD 210

  Fly   197 SMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLR---------D 252
            .: |:|         |:.|:||||.|||:|.|.|.:|..||.:.:...:.|.:||         :
Mouse   211 PL-LRD---------YWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVE 265

  Fly   253 SRDQRVLNTYRELQDGHDRPV 273
            ..|..:.:.:|..|...||.:
Mouse   266 GCDGILGDNFRPTQPLSDRVI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 75/267 (28%)
Car8NP_031618.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
alpha_CARP_VIII 36..290 CDD:239394 76/278 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.