DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca11

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_002938168.2 Gene:ca11 / 100493884 XenbaseID:XB-GENE-6037596 Length:330 Species:Xenopus tropicalis


Alignment Length:291 Identity:79/291 - (27%)
Similarity:133/291 - (45%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VARSFAP-------INSGTRSHFGFNYDKQGRDWNVKC--GERQSPIALWSCNAITCNVPKLKFL 59
            |..||.|       :||.               ||: |  |:|||||.:        |..::.| 
 Frog    40 VQGSFVPGPAFWGLVNSA---------------WNL-CTIGKRQSPINI--------NTSQIIF- 79

  Fly    60 NYHKSLCDPLSVINNGLTVLMRIPKT-------VDGSRPSLCISTEGQQVF---EADQLHFHWGS 114
               .....||.:...|.||...:..|       :|..:|   ::..|..:.   ..:::..|:||
 Frog    80 ---DPFLPPLRLSMTGTTVSGTMHNTGRHVSFRLDKEQP---VNISGGPLLYNHRLEEVMLHFGS 138

  Fly   115 ALSKGSEHCLDGNYYDGEVHIVHKNASYKSN-KEAGLQPNGFAVLALFIRNLEDPNIETPAMNMI 178
            ..|.||||.::.....|||.::|.|....|| .||...|||.||::||: |:.| |..:....|:
 Frog   139 ENSIGSEHLMNKETSAGEVQLIHYNQDLYSNVTEASRNPNGLAVISLFL-NVAD-NSNSFLNRML 201

  Fly   179 CKQ-VSSITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKE 242
            .:: ::.|:..:::..::| ::::||:.  |:..:.|||||:|.|||.|.|.|.|...||::...
 Frog   202 NRETITRISFRNEATYIQD-LSIEDLYP--DTFGFLTYQGSMTIPPCYETVTWIVIDRPLNITSM 263

  Fly   243 LWKHFWQLRDSRDQRVLNTYRELQDGHDRPV 273
            .......|..::..::   ::.:.|.. |||
 Frog   264 QMHSLRLLSQNQPSQI---FQSMSDNF-RPV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 70/251 (28%)
ca11XP_002938168.2 alpha_CARP_X_XI_like 47..303 CDD:239395 75/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.