DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and Car10

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_017453181.1 Gene:Car10 / 100360015 RGDID:2322930 Length:328 Species:Rattus norvegicus


Alignment Length:286 Identity:74/286 - (25%)
Similarity:131/286 - (45%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVARSFAPINSGTRSHFGFNYDKQGRDWNV-KCGERQSPIALWSCNAITCNVPKLKFLNYHKSLC 66
            :|..||.|:    .|.:|.    ....||: ..|:||||:     |..|.::....||.      
  Rat    38 VVQGSFVPV----PSFWGL----VNSAWNLCSVGKRQSPV-----NIETSHMIFDPFLT------ 83

  Fly    67 DPLSVINNGLTVLMRIPKTVDGSRPSLCISTE-------GQQVF--EADQLHFHWGSALSKGSEH 122
             ||.:...|..|...:..|  |...||.:..|       |...:  ..:::..|:||..|:||||
  Rat    84 -PLRINTGGRKVSGTMYNT--GRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEH 145

  Fly   123 CLDGNYYDGEVHIVHKNAS-YKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQ--VSS 184
            .|:|..:.|||.::|.|.. |.:..||...|||..|:::||:..:..|   |.:|.:..:  ::.
  Rat   146 LLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSN---PFLNRMLNRDTITR 207

  Fly   185 ITKLDDSCPLEDSMALQDLFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQ 249
            ||..:|:..|: .:.:::|:.  ::..:.||.||:|.|||.|...|.:...|:.:.:........
  Rat   208 ITYKNDAYLLQ-GLNIEELYP--ETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRL 269

  Fly   250 LRDSRDQRVL----NTYRELQDGHDR 271
            |..::..::.    :.:|.:|..::|
  Rat   270 LSQNQPSQIFLSMSDNFRPVQPLNNR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 66/253 (26%)
Car10XP_017453181.1 alpha_CARP_X_XI_like 46..302 CDD:239395 70/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.