DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH4 and ca14

DIOPT Version :9

Sequence 1:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001103521.1 Gene:ca14 / 100126213 XenbaseID:XB-GENE-855636 Length:343 Species:Xenopus tropicalis


Alignment Length:262 Identity:87/262 - (33%)
Similarity:131/262 - (50%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DWNV---KC-GERQSPIALWSCN-AITCNVPKLKFLNYHKSLCDPLSVINNGLTVLMRIPKTVDG 88
            :|.|   .| |..||||.:.:.| :...::|.::...|:.....|.::.|||.:|.:.:|.:   
 Frog    31 NWPVTYPDCGGTAQSPINIQTSNISYDESLPPIEPEGYNTPGNQPFTLTNNGHSVELSLPSS--- 92

  Fly    89 SRPSLCISTEG-QQVFEADQLHFHWGS-ALSKGSEHCLDGNYYDGEVHIVHKNA-SYKSNKEAGL 150
                  ::..| ...|:|.|||.|||| |...||||.|||..:..|:||||.|: .|....||..
 Frog    93 ------MTLRGLPNTFKAAQLHLHWGSPAKQAGSEHRLDGEEFPAELHIVHYNSDKYADISEAKN 151

  Fly   151 QPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYFTY 215
            :|:|.|||.:|   .|....:.||...|...:.:|...|.:..: .|..::.|... :.::||.|
 Frog   152 KPDGLAVLGVF---FEIGATDNPAYANILHHLDNIRYKDQTVSV-PSFNVRHLLPE-NLEEYFRY 211

  Fly   216 QGSLTTPPCAEAVIWFVFPTPLDVPK-ELWKHFWQLRDSRDQRVL-----NTYRELQDGHDRPVY 274
            |||||||||.::|:|.||..|:::.: :|.|....|..:....|.     |..||.|..:.|.||
 Frog   212 QGSLTTPPCYQSVLWTVFYHPVEISRSQLEKLQTTLYSTTATEVPPEVLGNNVREAQLLNSRTVY 276

  Fly   275 RS 276
            .|
 Frog   277 SS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 81/248 (33%)
ca14NP_001103521.1 alpha_CA 28..279 CDD:294017 87/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4459
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.