DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7006 and NIP7

DIOPT Version :9

Sequence 1:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_015113.1 Gene:NIP7 / 855890 SGDID:S000006132 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:84/180 - (46%)
Similarity:127/180 - (70%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSERILKLSECFGYKQLVC 65
            |::|::|..|::||.|:.|||.|:..|:|..:..:.||..|||||||.:.:.||:.......|:.
Yeast     1 MRQLTEEETKVVFEKLAGYIGRNISFLVDNKELPHVFRLQKDRVYYVPDHVAKLATSVARPNLMS 65

  Fly    66 VGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVKPSFEQQFLYGNHIPKTGLGRITENAGQYQG 130
            :|.|.|||:||.|.:.|||:|..||.:|:||:|:||:.|..||||||:.|..:|:::::..::.|
Yeast    66 LGICLGKFTKTGKFRLHITSLTVLAKHAKYKIWIKPNGEMPFLYGNHVLKAHVGKMSDDIPEHAG 130

  Fly   131 VVVYSMNDLPLGFGVLARSTTDCKTADPMTTVCFHQSDIGEYIRAEDTLF 180
            |:|::|||:||||||.|:||::.:...|...|.|.|:|||||:|.|||||
Yeast   131 VIVFAMNDVPLGFGVSAKSTSESRNMQPTGIVAFRQADIGEYLRDEDTLF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7006NP_651296.1 PUA 1..177 CDD:294405 79/175 (45%)
NIP7NP_015113.1 NIP7 1..177 CDD:224293 79/175 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346559
Domainoid 1 1.000 94 1.000 Domainoid score I1684
eggNOG 1 0.900 - - E1_COG1374
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56743
Inparanoid 1 1.050 188 1.000 Inparanoid score I922
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53780
OrthoFinder 1 1.000 - - FOG0005084
OrthoInspector 1 1.000 - - oto100400
orthoMCL 1 0.900 - - OOG6_102224
Panther 1 1.100 - - LDO PTHR23415
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R812
SonicParanoid 1 1.000 - - X3604
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.