DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7006 and Nip7

DIOPT Version :9

Sequence 1:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_079667.2 Gene:Nip7 / 66164 MGIID:1913414 Length:180 Species:Mus musculus


Alignment Length:179 Identity:117/179 - (65%)
Similarity:145/179 - (81%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSERILKLSECFGYKQLVC 65
            |:.|::|..:::||.::||||.|::.|:||||||||||.|.||||||||.:|||:......:||.
Mouse     1 MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEMMLKLAANISGDKLVS 65

  Fly    66 VGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVKPSFEQQFLYGNHIPKTGLGRITENAGQYQG 130
            :|||||||:||:|.:.|:|||.||||||:|||||||..||.||||||:.|:||||||||..||||
Mouse    66 LGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWVKPGAEQSFLYGNHVLKSGLGRITENTSQYQG 130

  Fly   131 VVVYSMNDLPLGFGVLARSTTDCKTADPMTTVCFHQSDIGEYIRAEDTL 179
            ||||||.|:||||||.|:||.||:..|||..|.|||:|||||:|.|:||
Mouse   131 VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7006NP_651296.1 PUA 1..177 CDD:294405 114/175 (65%)
Nip7NP_079667.2 NIP7 1..176 CDD:224293 114/174 (66%)
N-terminal domain. /evidence=ECO:0000250 1..92 52/90 (58%)
C-terminal domain. /evidence=ECO:0000250 93..180 63/87 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850196
Domainoid 1 1.000 129 1.000 Domainoid score I5269
eggNOG 1 0.900 - - E1_COG1374
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56743
Inparanoid 1 1.050 257 1.000 Inparanoid score I3140
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53780
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005084
OrthoInspector 1 1.000 - - oto95437
orthoMCL 1 0.900 - - OOG6_102224
Panther 1 1.100 - - LDO PTHR23415
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R812
SonicParanoid 1 1.000 - - X3604
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.