DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7006 and NIP7

DIOPT Version :9

Sequence 1:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_057185.1 Gene:NIP7 / 51388 HGNCID:24328 Length:180 Species:Homo sapiens


Alignment Length:179 Identity:116/179 - (64%)
Similarity:146/179 - (81%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLSDERAKILFEHLSKYIGTNVKHLIDRPDGTYCFREHKDRVYYVSERILKLSECFGYKQLVC 65
            |:.|::|..:::||.::||||.|::.|:||||||||||.|.||||||||:|:||:......:||.
Human     1 MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVS 65

  Fly    66 VGTCFGKFSKTNKLKFHITALYYLAPYAQYKVWVKPSFEQQFLYGNHIPKTGLGRITENAGQYQG 130
            :|||||||:||:|.:.|:|||.||||||:||||:||..||.||||||:.|:||||||||..||||
Human    66 LGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQG 130

  Fly   131 VVVYSMNDLPLGFGVLARSTTDCKTADPMTTVCFHQSDIGEYIRAEDTL 179
            ||||||.|:||||||.|:||.||:..|||..|.|||:|||||:|.|:||
Human   131 VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7006NP_651296.1 PUA 1..177 CDD:294405 113/175 (65%)
NIP7NP_057185.1 NIP7 1..176 CDD:224293 113/174 (65%)
N-terminal domain 1..92 52/90 (58%)
C-terminal domain 93..180 62/87 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159827
Domainoid 1 1.000 129 1.000 Domainoid score I5283
eggNOG 1 0.900 - - E1_COG1374
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56743
Inparanoid 1 1.050 258 1.000 Inparanoid score I3150
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53780
OrthoDB 1 1.010 - - D1405073at2759
OrthoFinder 1 1.000 - - FOG0005084
OrthoInspector 1 1.000 - - oto91860
orthoMCL 1 0.900 - - OOG6_102224
Panther 1 1.100 - - LDO PTHR23415
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R812
SonicParanoid 1 1.000 - - X3604
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.