powered by:
Protein Alignment CG7006 and Cks85A
DIOPT Version :9
Sequence 1: | NP_651296.1 |
Gene: | CG7006 / 42963 |
FlyBaseID: | FBgn0039233 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246992.1 |
Gene: | Cks85A / 41034 |
FlyBaseID: | FBgn0037613 |
Length: | 96 |
Species: | Drosophila melanogaster |
Alignment Length: | 48 |
Identity: | 15/48 - (31%) |
Similarity: | 19/48 - (39%) |
Gaps: | 13/48 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 FEQQFLY---------GNHIPKTGLGRITE--NAG--QYQGVVVYSMN 137
|:..|.| ..|:||..|...|| |.| |..|.|.|.::
Fly 13 FDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVH 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7006 | NP_651296.1 |
PUA |
1..177 |
CDD:294405 |
15/48 (31%) |
Cks85A | NP_001246992.1 |
CKS |
8..73 |
CDD:279455 |
15/48 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45471275 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR23415 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.