DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7006 and Cks85A

DIOPT Version :9

Sequence 1:NP_651296.1 Gene:CG7006 / 42963 FlyBaseID:FBgn0039233 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001246992.1 Gene:Cks85A / 41034 FlyBaseID:FBgn0037613 Length:96 Species:Drosophila melanogaster


Alignment Length:48 Identity:15/48 - (31%)
Similarity:19/48 - (39%) Gaps:13/48 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FEQQFLY---------GNHIPKTGLGRITE--NAG--QYQGVVVYSMN 137
            |:..|.|         ..|:||..|...||  |.|  |..|.|.|.::
  Fly    13 FDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVH 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7006NP_651296.1 PUA 1..177 CDD:294405 15/48 (31%)
Cks85ANP_001246992.1 CKS 8..73 CDD:279455 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23415
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.