Sequence 1: | NP_733043.1 | Gene: | RabX4 / 42960 | FlyBaseID: | FBgn0051118 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017979.1 | Gene: | RAB28 / 9364 | HGNCID: | 9768 | Length: | 221 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 57/200 - (28%) |
---|---|---|---|
Similarity: | 93/200 - (46%) | Gaps: | 18/200 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDG-VPIKLQIWDTAGQERFRTL 73
Fly 74 TTAYYRGAMGILLMYDVTNLESYNNLSYW---LRNIQENASPDVVKVLAGNKCECSATQRMVDKE 135
Fly 136 RGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI-----------REQRERRGD--NFDNDESK 187
Fly 188 DKKSP 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX4 | NP_733043.1 | RAB | 9..170 | CDD:197555 | 51/163 (31%) |
RAB28 | NP_001017979.1 | Rab28 | 13..221 | CDD:206694 | 56/199 (28%) |
Effector region. /evidence=ECO:0000250 | 41..49 | 4/7 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |