DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RABG3A

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001154217.1 Gene:RABG3A / 826558 AraportID:AT4G09720 Length:217 Species:Arabidopsis thaliana


Alignment Length:177 Identity:72/177 - (40%)
Similarity:107/177 - (60%) Gaps:19/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74
            ||:|||||.||||.::::|..:|:...|.:|||.||..|.:.:....:.||||||||||||::|.
plant    10 KVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQIWDTAGQERFQSLG 74

  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYW------------LRNIQENASPDVVK----VLAGNKC 123
            .|:||||....|:|||..|.|::||..|            :..|.| |||...|    ::.|||.
plant    75 AAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMWTIAE-ASPSDPKTFPFIVLGNKI 138

  Fly   124 EC-SATQRMV-DKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLAR 168
            :. ..:.|:| ||:..:..|.|.::|:||.|.|.:.|:::|||::|:
plant   139 DVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEAFLTIAK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 72/177 (41%)
RABG3ANP_001154217.1 Rab7 9..193 CDD:206655 72/177 (41%)

Return to query results.
Submit another query.