DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RABE1c

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001078248.1 Gene:RABE1c / 823749 AraportID:AT3G46060 Length:216 Species:Arabidopsis thaliana


Alignment Length:170 Identity:88/170 - (51%)
Similarity:129/170 - (75%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQE 68
            |:....|:|::|||.|||:|::.|:.|..:..::|:|||||||.:.|.|||..||||||||||||
plant    11 DYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQE 75

  Fly    69 RFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVD 133
            ||||:|||||||||||||:||||:..|:||:..|:|||:::||.:|.|:|.|||.:...::|.|.
plant    76 RFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVP 140

  Fly   134 KERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQ 173
            ..:|:.:|:.:.:.|||.|.|:|:|:|:.|.|:.|.|:::
plant   141 TAKGQALADEYGIKFFETSAKTNLNVEEVFFSIGRDIKQR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 86/160 (54%)
RABE1cNP_001078248.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 87/166 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.