DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RABA1g

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_188124.1 Gene:RABA1g / 820735 AraportID:AT3G15060 Length:217 Species:Arabidopsis thaliana


Alignment Length:192 Identity:68/192 - (35%)
Similarity:113/192 - (58%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQE 68
            |:...|||:::|||.|||:.::.|:...::.....||||::|..:.|::|...:|.|||||||||
plant     9 DYDFLYKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDEKIVKAQIWDTAGQE 73

  Fly    69 RFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVD 133
            |:|.:|:||||||:|.||:||||...::.|:..||:.::::...::|.:|.|||.:.... |.|.
plant    74 RYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTEANIVIMLVGNKADLRHL-RAVS 137

  Fly   134 KERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSN 195
            .|..:..||..:..|.|.|....:|:|:||..:..:|.....::..:..:|.:...|....|
plant   138 TEDAKAFAERENTFFMETSALEALNVENAFTEVLSQIYRVASKKALDIGDDHTTLPKGQSIN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 63/160 (39%)
RABA1gNP_188124.1 Rab11_like 11..175 CDD:206660 63/164 (38%)

Return to query results.
Submit another query.