DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and RAB1B

DIOPT Version :10

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_112243.1 Gene:RAB1B / 81876 HGNCID:18370 Length:201 Species:Homo sapiens


Alignment Length:165 Identity:83/165 - (50%)
Similarity:126/165 - (76%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|:|::|||.|||:|::.|:.|:.|.::||||||:|||.:.|.|||..||||||||||||||||:
Human     9 FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTI 73

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            |::|||||.||:::||||:.|||.|:..||:.|...||.:|.|:|.|||.:.: |:::||....:
Human    74 TSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLT-TKKVVDNTTAK 137

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQ 173
            :.|::..:||.|.|.|:..|:|.||:::|.:|:::
Human   138 EFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 82/160 (51%)
RAB1BNP_112243.1 Rab1_Ypt1 7..172 CDD:206661 83/163 (51%)
Switch 1. /evidence=ECO:0000269|PubMed:20064470, ECO:0007744|PDB:3JZA 30..45 8/14 (57%)
Switch 2 region, required for interaction with REP1/CHM 64..83 15/18 (83%)
Switch 2. /evidence=ECO:0000269|PubMed:20064470, ECO:0007744|PDB:3JZA 65..80 11/14 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..201
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.