DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX4 and Rab1a

DIOPT Version :9

Sequence 1:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_112352.2 Gene:Rab1a / 81754 RGDID:619736 Length:205 Species:Rattus norvegicus


Alignment Length:165 Identity:83/165 - (50%)
Similarity:128/165 - (77%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73
            :|:|::|||.|||:|::.|:.|:.|.::||||||:|||.:.|.|||..||||||||||||||||:
  Rat    12 FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTI 76

  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138
            |::|||||.||:::||||:.||:||:..||:.|...||.:|.|:|.||||:.: |:::||....:
  Rat    77 TSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT-TKKVVDYTTAK 140

  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQ 173
            :.|::..:||.|.|.|:..|:|.:|:::|.:|:::
  Rat   141 EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX4NP_733043.1 RAB 9..170 CDD:197555 82/160 (51%)
Rab1aNP_112352.2 Rab1_Ypt1 10..175 CDD:206661 83/163 (51%)
Effector region. /evidence=ECO:0000255 40..48 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.